PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN45498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 337aa    MW: 36998.3 Da    PI: 8.0343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN45498.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+Wk++++  g+ R+ k+c++rw +yl
       KHN45498.1 13 KGPWTPEEDIILVSYIQEHGPGNWKAVPANTGLSRCSKSCRLRWTNYL 60
                     79********************************************97 PP

2Myb_DNA-binding50.45.3e-1666111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w++yl
       KHN45498.1  66 RGNFTDQEEKMIIHLQALLGNR-WAAIAAYLP-QRTDNDIKNYWNTYL 111
                      89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.964864IPR017930Myb domain
SuperFamilySSF466899.54E-3110107IPR009057Homeodomain-like
SMARTSM007171.7E-151262IPR001005SANT/Myb domain
PfamPF002496.6E-171360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-241467IPR009057Homeodomain-like
CDDcd001673.58E-121560No hitNo description
SMARTSM007172.0E-1565113IPR001005SANT/Myb domain
PROSITE profilePS5129420.4765115IPR017930Myb domain
PfamPF002493.4E-1566111IPR001005SANT/Myb domain
CDDcd001677.11E-1168110No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2468116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRPPCCDKG VKKGPWTPEE DIILVSYIQE HGPGNWKAVP ANTGLSRCSK SCRLRWTNYL  60
RPGIKRGNFT DQEEKMIIHL QALLGNRWAA IAAYLPQRTD NDIKNYWNTY LKKKLNKKLE  120
AGSDQGSLLG GGHNNIGFSS VSQPMSRGQW ERRLQTDIHM AKKALSEALS PNKASSSSST  180
LLAESNSNLS NENSTFYNSN TNKPTTTQSM CYASSADNIA RLLKGWMKNT PKSASCAASA  240
VTQNSCSSSE GITTTKGSTT STSTVELSET FESLFGYESF DNYSSNSEFS PSLSPEATLF  300
QDEGKPDITT GLIDMPFSLF EKWLLDVDAG SQEKLGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-26131154105MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-261311558159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-261311558159MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-261311527128MYB TRANSFORMING PROTEIN
1mse_C1e-26131154105C-Myb DNA-Binding Domain
1msf_C1e-26131154105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0961950.0BT096195.1 Soybean clone JCVI-FLGm-20D5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554888.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-110MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B2SKT40.0A0A0B2SKT4_GLYSO; Myb-related protein 306
STRINGGLYMA19G02600.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.14e-83myb domain protein 30
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]